PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g036178m
Common NameCISIN_1g036178mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 331aa    MW: 36084 Da    PI: 6.8271
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g036178mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.7e-392989262
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+ss
  orange1.1g036178m 29 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRSS 89
                       57899****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-282787IPR003851Zinc finger, Dof-type
PfamPF027013.8E-333187IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6743387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MQDIHSIGGG RLFGGGGGDR RLRPHPHQNH QALKCPRCDS LNTKFCYYNN YNLSQPRHFC  60
KNCRRYWTKG GVLRNVPVGG GCRKTKRSSK PKPNSESSAQ TQTQTQTEAP AAGERDRKAN  120
SHSSSESSST LTVTNNNNNN NNTSVETVSV HSSSSVSNVL SAMNNNNNNN NNDPGFETAP  180
TTALLDQASS DCGIFSEIGS FTSLITSSNE ALPFGFSNLL NNAQQNLEHV QNEQQWQQEQ  240
QKLASASSMG GHHELKLHEM ASGLLDQTVH DELSALQDRS GNTGGFGSLD WHGSADHQGL  300
FDLPNAVDHA SYWSQSTQWT DQDHPSLYLP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1816GGRLFGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.62240.0flower| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006440822.11e-179hypothetical protein CICLE_v10021100mg
TrEMBLA0A067FHN40.0A0A067FHN4_CITSI; Uncharacterized protein
STRINGPOPTR_0012s12670.12e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44822656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.14e-39OBF binding protein 4